Insulin
Metabolic Peptide HormoneapprovedAlso known as: Humulin, Novolin, Humalog, Lantus, Insulin Lispro, Regular Insulin
A 51-amino acid peptide hormone produced by pancreatic beta cells that regulates blood glucose, promotes nutrient uptake into cells, and is used medically for diabetes and off-label in bodybuilding as a powerful anabolic agent.
Overview
Insulin is a peptide hormone consisting of two chains (A-chain: 21 amino acids, B-chain: 30 amino acids) linked by disulfide bonds, produced by the beta cells of the pancreatic islets of Langerhans. It is the master regulator of blood glucose and one of the most anabolic hormones in the body. In medicine, exogenous insulin is essential for type 1 diabetes management and often used in type 2 diabetes. In the bodybuilding world, insulin is used as a potent anabolic agent — it drives amino acids, glucose, and creatine into muscle cells, dramatically enhancing muscle protein synthesis and glycogen storage. However, insulin misuse is extremely dangerous: incorrect dosing can cause life-threatening hypoglycemia, coma, and death. It is considered one of the highest-risk compounds used in performance enhancement. Modern insulin analogues include rapid-acting (Humalog, NovoRapid), short-acting (Regular/Humulin R), intermediate (NPH), and long-acting (Lantus, Levemir) formulations.
Mechanism of Action
Insulin binds to the insulin receptor (IR), a receptor tyrosine kinase, triggering autophosphorylation and activation of the IRS/PI3K/Akt signaling cascade. Key downstream effects: (1) GLUT4 transporter translocation to cell membranes, increasing glucose uptake 10-20x in muscle and fat; (2) Activation of mTOR pathway, powerfully stimulating muscle protein synthesis; (3) Stimulation of glycogen synthase, driving glycogen storage in muscle and liver; (4) Inhibition of lipolysis via suppression of hormone-sensitive lipase; (5) Promotion of lipogenesis and fat storage; (6) Suppression of hepatic glucose production; (7) Enhancement of amino acid uptake and protein synthesis while inhibiting protein breakdown (anti-catabolic). Insulin's anabolic effects on muscle are synergistic with growth hormone and IGF-1.
Molecular Formula
C257H383N65O77S6
Molecular Weight
5808 Da
Sequence
A-chain: GIVEQCCTSICSLYQLENYCN; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Dosage Protocols
Dose Range
Variable – Variable
Frequency
Multiple daily injections or continuous pump
Route
subcutaneous
Cycle Length
Ongoing (lifelong for T1DM)
Dosing is highly individualized based on blood glucose monitoring, carbohydrate intake, and insulin sensitivity. Must be prescribed and managed by a physician.
Source: ADA clinical guidelines
🧮 Personalized Dosage Calculator
💰 Estimated Pricing
Typical Supply
10mL vial (100 units/mL)
Last Updated
2026-02
FDA-approved. Walmart ReliOn: $25/vial. Brand analogs (Humalog, Novolog): $150-300 without insurance. Insulin caps in many states.
⚠️ Prices are estimates based on publicly available data and may vary significantly by vendor, location, and prescription status. This is not medical or financial advice.
Side Effects
| Effect | Severity |
|---|---|
| Hypoglycemia | severe |
| Fat gain | moderate |
| Injection site lipodystrophy | moderate |
| Weight gain | moderate |
| Edema | mild |
Pros & Cons
One of the most powerful anabolic agents known — drives massive nutrient uptake into muscle cells
Synergistic with GH and IGF-1 for muscle growth — cornerstone of advanced bodybuilding protocols
Well-understood pharmacology with over 100 years of clinical use
Inexpensive and widely available
CAN KILL YOU — hypoglycemia from incorrect dosing is a medical emergency that can result in death
Promotes fat storage alongside muscle growth if nutrition is not precisely managed
Chronic use in non-diabetics may cause insulin resistance and metabolic dysfunction
No margin for error — requires meticulous dosing, carb management, and glucose monitoring
Risk of long-term pancreatic beta cell suppression with chronic exogenous use
Research Studies
🩸 Blood Work
Fasting Blood Glucose
CRITICAL — insulin directly lowers blood sugar, hypoglycemia can be fatal
HbA1c
Long-term glucose control assessment
Fasting Insulin
Baseline endogenous insulin levels
C-Peptide
Differentiates endogenous vs exogenous insulin
Lipid Panel
Insulin affects lipid metabolism
Kidney Function (BMP/CMP)
Electrolyte monitoring — insulin shifts potassium
Liver Function Panel (AST/ALT)
Insulin affects hepatic metabolism
EXTREME CAUTION — exogenous insulin can cause fatal hypoglycemia. Blood glucose monitoring is mandatory before every administration. This is one of the most dangerous peptides/hormones to use without medical supervision. Always have fast-acting glucose available.
Legal Status
FDA-approved prescription medication for diabetes. Available OTC (without prescription) in some US states for regular insulin. Prescription required for analogues. Not a controlled substance in the US. Banned by WADA for non-diabetic athletes.
Readers Also Viewed
Semaglutide
99An FDA-approved GLP-1 receptor agonist used for type 2 diabetes and chronic weight management, producing significant weight loss of 15-17% body weight in clinical trials.
BPC-157
98A 15-amino acid synthetic peptide derived from human gastric juice that promotes healing of tendons, ligaments, muscles, gut lining, and other tissues through multiple regenerative pathways.
Tirzepatide
97A first-in-class dual GIP/GLP-1 receptor agonist that produces up to 22.5% body weight loss, approved for type 2 diabetes and obesity management.
CJC-1295 + Ipamorelin (Combo)
95The most popular growth hormone peptide combination, pairing a GHRH analog (CJC-1295) with a ghrelin mimetic (Ipamorelin) for synergistic GH release with minimal side effects.
Related Peptides
Semaglutide
An FDA-approved GLP-1 receptor agonist used for type 2 diabetes and chronic weight management, producing significant weight loss of 15-17% body weight in clinical trials.
BPC-157
A 15-amino acid synthetic peptide derived from human gastric juice that promotes healing of tendons, ligaments, muscles, gut lining, and other tissues through multiple regenerative pathways.
Tirzepatide
A first-in-class dual GIP/GLP-1 receptor agonist that produces up to 22.5% body weight loss, approved for type 2 diabetes and obesity management.
CJC-1295 + Ipamorelin (Combo)
The most popular growth hormone peptide combination, pairing a GHRH analog (CJC-1295) with a ghrelin mimetic (Ipamorelin) for synergistic GH release with minimal side effects.